Protein Info for BPHYT_RS10635 in Burkholderia phytofirmans PsJN

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF00126: HTH_1" amino acids 3 to 61 (59 residues), 90.6 bits, see alignment E=4.9e-30 PF03466: LysR_substrate" amino acids 88 to 290 (203 residues), 158 bits, see alignment E=2.2e-50

Best Hits

Swiss-Prot: 54% identical to CYNR_ECOLI: HTH-type transcriptional regulator CynR (cynR) from Escherichia coli (strain K12)

KEGG orthology group: K11921, LysR family transcriptional regulator (inferred from 100% identity to bpy:Bphyt_2145)

Predicted SEED Role

"Cyn operon transcriptional activator" in subsystem Cyanate hydrolysis or DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4N5 at UniProt or InterPro

Protein Sequence (304 amino acids)

>BPHYT_RS10635 transcriptional regulator (Burkholderia phytofirmans PsJN)
MLLRHIRYFLAVAEHRNFTRAAEALHVSQPTLSQQIKQLEDTLRVQLLDRSGRTIQLTDA
GTAYVHYAQRALQDLEAGKRAIHDVEELSRGSLRLAMTPTFTAYLIGPLLEKYNRRYPNI
TLNILEMPQDRMEALLSEDALDVGIAFDDTNTPDIETQTLFVEALAMVVGKAHPYAKRRS
ALKLSQFQNEALVLLNEEFATRQYIDRYCKLHGVSPRIAMEVNSIGAIVQIVRRSALATL
LPAAIAREQSELFLVQLEPALPQRTAALLLRKGAYRNAATRAFIALAVEERAADTGGRRA
KAVL