Protein Info for BPHYT_RS10620 in Burkholderia phytofirmans PsJN

Annotation: 2-aminoethylphosphonate:pyruvate aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 TIGR02326: 2-aminoethylphosphonate--pyruvate transaminase" amino acids 28 to 386 (359 residues), 478.7 bits, see alignment E=1.2e-147 TIGR03301: 2-aminoethylphosphonate aminotransferase" amino acids 30 to 384 (355 residues), 461.8 bits, see alignment E=1.9e-142 PF00266: Aminotran_5" amino acids 145 to 315 (171 residues), 50.3 bits, see alignment E=9.3e-18

Best Hits

Swiss-Prot: 92% identical to PHNW1_PARXL: 2-aminoethylphosphonate--pyruvate transaminase 1 (phnW1) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K03430, 2-aminoethylphosphonate-pyruvate transaminase [EC: 2.6.1.37] (inferred from 100% identity to bpy:Bphyt_2142)

MetaCyc: 52% identical to 2-aminoethylphosphonate aminotransferase monomer (Pseudomonas aeruginosa)
2-aminoethylphosphonate--pyruvate transaminase. [EC: 2.6.1.37]

Predicted SEED Role

"2-aminoethylphosphonate:pyruvate aminotransferase (EC 2.6.1.37)" in subsystem Phosphonate metabolism (EC 2.6.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.37

Use Curated BLAST to search for 2.6.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4N2 at UniProt or InterPro

Protein Sequence (410 amino acids)

>BPHYT_RS10620 2-aminoethylphosphonate:pyruvate aminotransferase (Burkholderia phytofirmans PsJN)
MDSVIDRSPAVNAAGSSAVTCAAPAKGEPYLLTPGPLTTAFSTKEAMLRDWGSWDGDFRA
MTALLRSSLLEIAGDTAGDYDCVPLQGSGSYCVEAMLGSLIPRDGHALVLANGAYGKRIA
TTLGYLGRAYTLLDKGDYLPPRGAEIEHMLDADSRITHVVAVHCETSSGILNPLEEIAAA
TAKKGRKLLIDSMSAFGAVPLDVREIACEAFVSSANKCIEGVPGFGFVIARKSALQEAKG
RSHSLALDVHDQWDVMNRTGQWRFTPPTHTVAAFIEALRLHKLEGGQAGRLARYANNRDV
LVAGMHELGFEPLLNARWRSPIIVTFFAPAHPSFSFEQFYELMKQQGFIIYPGKLTVVDS
FRIGCIGQVDEDVMRRVVAACGNALRTMGVEHAAPPAAALDERKRLADAA