Protein Info for BPHYT_RS10555 in Burkholderia phytofirmans PsJN

Annotation: integral membrane sensor hybrid histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 645 transmembrane" amino acids 52 to 70 (19 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 144 to 159 (16 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 576 to 593 (18 residues), see Phobius details PF00512: HisKA" amino acids 260 to 323 (64 residues), 27.3 bits, see alignment E=4.5e-10 PF02518: HATPase_c" amino acids 371 to 477 (107 residues), 63.6 bits, see alignment E=3.4e-21 PF00072: Response_reg" amino acids 507 to 590 (84 residues), 35.1 bits, see alignment E=2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2129)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4L9 at UniProt or InterPro

Protein Sequence (645 amino acids)

>BPHYT_RS10555 integral membrane sensor hybrid histidine kinase (Burkholderia phytofirmans PsJN)
MNCTLPYPRTANFLIGVVMRSSGLRVRRFSSPAQERAFRCDYARRFSVQRRLAITIFTAL
WIVFSIRDFYRLDALDPAHLHHNELILLRVAAAIGMTIPVLFWTPRALDERWAVRLLAVW
TISCWFSCLRMLQFYPGDLGWREVYPVLLFCLFLIFMAFRLRVITAAWLIGICVVSYLIM
LYFKPAGGSVEMRVESVAAHATMLPMMSIVGVLLSIPLERAARREFMYRRTLRAAKARVE
VASRAVSEQNRRMQELVKEKERFFSSAYHDIQQPLAAINLFIRSARTRIRDGHAVDRDLD
VIEETASDILDMFKDIQDYSELGSYVPRVVPVDTLGLLTEVFEQYRETARLRGIELRIAG
RRRAPPSIETDRSLFKRSLSNLISNAIKNTPSGGVVLGWVQLDERLRVDVWDTGIGIAAG
HREAIFSEYYQINNPGRDRSKGLGLGLSIVHRAIHILPGHSMSFASGEGRGSRFSLYAAV
SASTPTVGAKALDGDAYTPDLTGTFMLLCDDEPTVLEGLRRLFSSAGALVHAAESMSGFE
AMLADDSRIPDLIVADIRLRDGATGKEVAERIRRHFAWAGVIPVAFITGELLSDQVLRDF
PEPFVLLRKSSAPIDLLVEISRYVSAQRKVNPALANHEALKASRA