Protein Info for BPHYT_RS10535 in Burkholderia phytofirmans PsJN

Annotation: DSBA oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details PF16576: HlyD_D23" amino acids 49 to 292 (244 residues), 60.8 bits, see alignment E=2.9e-20 PF13533: Biotin_lipoyl_2" amino acids 52 to 93 (42 residues), 47.4 bits, see alignment 3.2e-16 PF00529: CusB_dom_1" amino acids 99 to 343 (245 residues), 27.7 bits, see alignment E=5.4e-10 PF13437: HlyD_3" amino acids 216 to 328 (113 residues), 54.9 bits, see alignment E=3.3e-18

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 100% identity to bpy:Bphyt_2126)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4L6 at UniProt or InterPro

Protein Sequence (358 amino acids)

>BPHYT_RS10535 DSBA oxidoreductase (Burkholderia phytofirmans PsJN)
MSSATRFSPRTIRLAAYAVILGVAVLACIWLFAGSTSETTNDAYVTADFTLVAPRVAGQV
SEVLVEDNQQVKAGQLLVRIDDRDFRAALMSAGADVAAARASVANYEAEIARQPALVDQA
RATLRADDATLEFARANAARYRNLSETGAGTTQEQQHAASALAEELAQQARNRAALVATV
QNLDVLKTQRDKAAGALARAEAMLEQAKLNLSYTEIHAPIDGKVGRRSARVGAFVTTGAP
LLAIVPLSEAYIVANFQENQLARMRPGDTVRIKVDSFPGVVIRGHVDSLAPATGVSFAPI
APDNATGNFTKIVQRVPVRITIDHGQQAAAALSVGLSVETEVAVGRRADMRVAGADSK