Protein Info for BPHYT_RS10495 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 769 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR03303: outer membrane protein assembly complex, YaeT protein" amino acids 32 to 769 (738 residues), 891.9 bits, see alignment E=1.8e-272 PF07244: POTRA" amino acids 33 to 99 (67 residues), 37.8 bits, see alignment E=4e-13 amino acids 101 to 180 (80 residues), 51.7 bits, see alignment E=1.8e-17 amino acids 184 to 271 (88 residues), 62.8 bits, see alignment E=6.1e-21 amino acids 274 to 351 (78 residues), 56.4 bits, see alignment E=5.9e-19 amino acids 355 to 429 (75 residues), 52.9 bits, see alignment E=7.3e-18 PF01103: Omp85" amino acids 456 to 769 (314 residues), 267.6 bits, see alignment E=3.1e-83

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2118)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4K8 at UniProt or InterPro

Protein Sequence (769 amino acids)

>BPHYT_RS10495 membrane protein (Burkholderia phytofirmans PsJN)
MNLQVLTSRLAGALSLAGIALTSGSAHAAQAFVVQDIRIEGLKRVEPGTLFAYLPIKQGD
TFSDEKASEAIRALYATGFFNEVRISTQGDTVVVSVQERPAVGTIDFAGIHEFDKENLTK
ALGSVGLSQGRYYDKALVDKAEQELKRQYLTRGYYAAEVTTTITPIDRNRVAVLFSVAEG
PSAKIRQINFIGNQAFSSDTLRDEMQLSTPNWFSWYTKNDLYAKDKLTGDLEHVRSYYLN
RGYLEFSIESTQVSLTPDKKEMYLTVTLHEGEPYTIASIGLAGNLLDREAELKKLVNIKA
GERFSAEKLQATTKAIVDKLGEYGYAFATVNAVPKIDQQRHTVDLTLQVDPSRRVYVRHI
NVVGNTRTRDEVVRREMRQLESSWFDSNRLTLSKDRVNRLGYFTDVDVTTVPVEGSPDQV
DVDVKVSEKPTGAITLGAGFSSTDKVVLSAGVSQDNVFGSGTSLAVNVNTAKTYRTLTVT
QTDPYFTVDGIKRITDVYYRTSYPLYNYTDTSFRIITMGADLKFGIPFSEADTVYFGVGL
EQNRLNTDSSTPQSYLDYVSEFGRVVNNVPLTTGWARDNRDSALVPSRGYFIQTNGEVGT
PAGGTEYYKADVQAQYYYSFARGFILGLNLQGGYGNGFAGKAYPIFKNYYAGGIGSVRGY
EAGSLGPTDKTTGDPIGGSRMVVANVEMTFPLPGSGWDRTLRVFTFLDAGNVWGDEGNST
GANGLRYSYGAGLEWISPIGPLKLSLGFPVVKHATDKYQKFQFQIGTSF