Protein Info for BPHYT_RS10480 in Burkholderia phytofirmans PsJN

Annotation: LPS biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 761 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF19838: LptD_2" amino acids 193 to 285 (93 residues), 25.2 bits, see alignment E=6.7e-10 PF04453: LptD" amino acids 290 to 662 (373 residues), 302.5 bits, see alignment E=5.9e-94

Best Hits

Swiss-Prot: 56% identical to LPTD_PARXL: LPS-assembly protein LptD (lptD) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2115)

Predicted SEED Role

"Outer membrane protein Imp, required for envelope biogenesis / Organic solvent tolerance protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4K5 at UniProt or InterPro

Protein Sequence (761 amino acids)

>BPHYT_RS10480 LPS biosynthesis protein (Burkholderia phytofirmans PsJN)
MLCAAGCAPLAGHAQLAGTAATPESLDGIWGLRLAPQLSEQVLRPGDRPVTFAIADSITT
TAGTDVALQGHAQLRRPASVVAGDALYYDVDRDKADAYGHVHLVDNGNVFDGPDAHFYVE
ANEGYISVPKYRFYLSGGWGSAERADVLDNERTVVRHGTYSTCQCESAPAWYLKASEFDI
DSGNDEGIAHNGVLFFQGVPLLASPWLSFPLSGVRRSGFLPPTFSVSSTNGVDVAFPYYF
NLAPNYDLTLTPRIMSRRGEMLTADYRYIQPNDSGTMSLAWLPHDAITGTQRYSIALNQN
WNLGSGLSAYVNYNRVSDSTVSTDLASGVAFPTGSTTLYQQEAGLNYTNGPWSVLAREQR
WQTFSSDSTYNREPQVNVRYARYGVGGFDFGAESDATRFTISSSDMTQGNRFVFNPYVSY
PIERPGWFITPKLAWHFAAYDLTSIGTDVPAGEPKSFSVNVPTFSLDSGMRFERSVRLFG
QSYIQTLEPRLFYVYTPYRNQAFVPLFDTATADFGLTELFMPNSFVGNDRVSDANRVTAA
LTTRFIDPASGDERARFILAEQYDFRTPRVTLETGDALSTVARTGVIAGASYKVGPDFTT
EQAVEYSQANHYLTHAEAGFGWAPGSRQVLNVAYRYTRANSTLDYQPVNQFIVSEQWPLA
HNVVSVARVNYDMSTHRLIAGLLGLEYDADCWSLGVAFEKYTNATSSTASPSTGTRVLMQ
LQLKGFSQVDNGLLNQFRANVPGYTPASTLNEPTSRFSDYP