Protein Info for BPHYT_RS10400 in Burkholderia phytofirmans PsJN

Annotation: taurine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 110 to 282 (173 residues), 84.5 bits, see alignment E=4e-28

Best Hits

Swiss-Prot: 33% identical to SSUC_BACSU: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2098)

MetaCyc: 34% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4I6 at UniProt or InterPro

Protein Sequence (290 amino acids)

>BPHYT_RS10400 taurine ABC transporter permease (Burkholderia phytofirmans PsJN)
MKLFKRSSQPEKSAGAACDCSAPASFRRAAQPRRPLLTRVDWRGAVLPVVAIVIWWAVSA
AHVGKSGLLVSPAQVLATAWQQIESGALLKALSASLAREASGFVIGTLGGLLLGSVLGFS
RLATRMIGPSFDTFKQISLFAWIPLISVWFGLGDVAKVVFLSLAALLPVTAHTCDGIHAV
PRAYIEVSRAFRYSRWQLIRAVILPAALPSIFTGIYLALIYSWLATLGAEYLLVAGSGIG
NTLIDGSEQFRMDLVLFGVIVIGVTGWALNALARAVERAIFARRFQPATR