Protein Info for BPHYT_RS10360 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details amino acids 388 to 411 (24 residues), see Phobius details amino acids 417 to 438 (22 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 351 (326 residues), 113.2 bits, see alignment E=2e-36 amino acids 307 to 441 (135 residues), 48.3 bits, see alignment E=1.1e-16 PF06779: MFS_4" amino acids 39 to 221 (183 residues), 36.2 bits, see alignment E=7.2e-13 PF00083: Sugar_tr" amino acids 50 to 450 (401 residues), 144 bits, see alignment E=1e-45

Best Hits

KEGG orthology group: K08369, MFS transporter, putative metabolite:H+ symporter (inferred from 100% identity to bpy:Bphyt_2088)

Predicted SEED Role

"Niacin transporter NiaP" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4I0 at UniProt or InterPro

Protein Sequence (456 amino acids)

>BPHYT_RS10360 MFS transporter (Burkholderia phytofirmans PsJN)
MSMIAARIERLPFSGFHRRLLLMGGLGYTFDAMDAAVLAFLLPVLRTQWVLTSVQTGVLG
SGTFMGYFVGAMLAGMLGDVIGRRKVMMYALVIYCVASLASALANDWGFFLATRIVAGLG
TGAESAIVAPFLSEFVARRYRGSFTGSLAGFFSFGFVAAALLGYLVIPLAPNAWRAVMVI
TALPIVMLLWWRRALPESPRWLEARDRHAEADAIVSRMEAEVLKAGVQLEPLPAAREEAV
PLAAGRASIIANVKALWAAKLARITAMTWLMWLSITFSYYAFFTWIPGLLVQNGMTITRS
FSYSLVIYIAQIPGYFSGAWLNEKIGRQATIASYMILGGISALGLALTGTDTGIMVSGIL
LSFFMNGTYAGVYAYTPEVFPTDVRATGTGLASSIGRLGAIAAPILVGYVYPRLGFAGVF
GATTLVLLIGAAAVLLMGVPTRGRSLEDIAAGQINP