Protein Info for BPHYT_RS10355 in Burkholderia phytofirmans PsJN

Annotation: nitrate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 39 to 76 (38 residues), see Phobius details amino acids 89 to 106 (18 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 184 to 208 (25 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 311 to 335 (25 residues), see Phobius details amino acids 353 to 369 (17 residues), see Phobius details amino acids 377 to 400 (24 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details amino acids 454 to 474 (21 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 18 to 445 (428 residues), 244.3 bits, see alignment E=1.2e-76

Best Hits

KEGG orthology group: K03457, nucleobase:cation symporter-1, NCS1 family (inferred from 100% identity to bpy:Bphyt_2087)

Predicted SEED Role

"Cytosine/purine/uracil/thiamine/allantoin permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4H9 at UniProt or InterPro

Protein Sequence (485 amino acids)

>BPHYT_RS10355 nitrate reductase (Burkholderia phytofirmans PsJN)
MEIRDPSPGLYNEDLAPSRVRNWGAFSIFNVWTSDVHSLWGYYLAASLFLLCGTFTNFVL
AIGIGSLVIFALMNLIGYAGEKTGVPYPVLARASFGVWGANLAALVRAVVACFWYGAQTA
AAAGALVALLIRNDSLMTFYKGTHFLGHSGLEVICYVVIWALQLLIIQKGMETVRKFQDW
AGPAVWVAMLILAIGLCVKAGGFSFSHGIPMDVLLDKTKDAGVSGEPGSFWALMAVGATW
ITYFAALYLNFCDFSRYARNRDAVKKGNLWGLPVNLIAFSLVAGITTIAAFKVYGEVLLH
PEQISAKFDSWVLALIAALTFAVATLGINVVANFVSAAFDISNVFPRQISFKKGGYIAAA
IALVLYPFAPWEGNAAHFVNAIGATMGPLLGIILVDYYLVAKGNINVAALYQEYGEYRYE
GGWNVNALIAAAIGSVFSTFLPNFTTLLPVWWNTYGWFFGVLIGGGTYLIMATLRPRAAV
APTRA