Protein Info for BPHYT_RS10340 in Burkholderia phytofirmans PsJN

Annotation: sensor protein Chase2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details transmembrane" amino acids 379 to 399 (21 residues), see Phobius details amino acids 419 to 439 (21 residues), see Phobius details amino acids 445 to 464 (20 residues), see Phobius details PF05226: CHASE2" amino acids 62 to 395 (334 residues), 175.1 bits, see alignment E=1.1e-55

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2084)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4H6 at UniProt or InterPro

Protein Sequence (465 amino acids)

>BPHYT_RS10340 sensor protein Chase2 (Burkholderia phytofirmans PsJN)
MKRYFAPRVAGIRRLLRTAQGRPVALALLFGLSLLNLTSEWPSDIPRPAFVDALDAALPD
SFKTARQILFNQYQRHYPRVPTAQPVTIVEIDEETLASVGQWPWPRDRLATLVDAIDALK
PLAIGLDIYMPEPDQTSPDMIAAALPKSAAALAAGLRALPSHEAILARSLRAAPTILGAA
PLDHAGLAARTDMRSAPILVHGADPLDSVQRFDYVLASLPELQAAAHGQAMLSVALDQGV
VRRIPLIMGLREKLVPSLPMEMLRLATGSSAIDVFADTSGVQAVGVADVQVPTQPGGDIW
LHFASIRSTLSRYVSARDVLQGSVDPARIRNKLVLVGLTGAGVTDMRTTALGELVPGIEI
QAQVIETIVEERFLRRPTWLKWAESAFIMTFGLLIIWYVPQRQSRFAVFMRSVPKGATVL
GLLLHLLNVVCCFLIFIRFGLLVDAASIFIILSAVMGSFLTPALL