Protein Info for BPHYT_RS10195 in Burkholderia phytofirmans PsJN

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 112 to 136 (25 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details amino acids 375 to 394 (20 residues), see Phobius details amino acids 406 to 427 (22 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 392 (368 residues), 179.8 bits, see alignment E=3.7e-57 amino acids 284 to 432 (149 residues), 38.8 bits, see alignment E=2.7e-14

Best Hits

Swiss-Prot: 43% identical to TUB3_AGRVI: Putative tartrate transporter (ttuB) from Agrobacterium vitis

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2054)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4F0 at UniProt or InterPro

Protein Sequence (445 amino acids)

>BPHYT_RS10195 major facilitator transporter (Burkholderia phytofirmans PsJN)
MNNASSSSADDGVFRKVARRIIPFIFVCYVVNFIDRVNIGFAKLQFLQDLKLDDSVFGIA
AGMFFVGYVIFELPSNLLAARIGVRKTLVRIMVLWGALTVVLVFVRSAHALYVVRFLLGA
AEAGFFPGVILYLTYWFPDRRRGRIMSLFVMAVPLAGIVGGPLSGWIMSHLHGELGFAGW
QWLFLIEGIPAIALGLAAYFVLDDRPADAKWLNDREKAQIATALNAGRARHAPEARSHAP
LADVLTNPRIYLMSTIYFTVFMALNAVGFWIPSLLRQVGVHRISDIGWMSGAISLCTAIG
MLLLGRHSDRHMERRWHVAGCGFAVAASFLLLPLTAHSVALTVVLLVIASVGIYAALSLF
WTIPTTYLREDTAPGGIATITALGALGGAVSPWMVGALKTSTGSLYTGLGAIGVLLAIGM
VVLLLCVQAVPASDRRPAGDAVVNH