Protein Info for BPHYT_RS10120 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 36 to 61 (26 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 167 to 183 (17 residues), see Phobius details PF01169: UPF0016" amino acids 6 to 80 (75 residues), 74.6 bits, see alignment E=3.2e-25 amino acids 106 to 180 (75 residues), 84.7 bits, see alignment E=2.3e-28

Best Hits

Swiss-Prot: 52% identical to MNEA_VIBC3: Putative manganese exporter (mneA) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2039)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4D5 at UniProt or InterPro

Protein Sequence (184 amino acids)

>BPHYT_RS10120 membrane protein (Burkholderia phytofirmans PsJN)
MQSFLVSTSVVGLAEIGDKTQLLSLVLAARYRKPIPIILGVFVATLINHAASGALGAWLA
SVLSPSILNWAVVASFAVMAVWILIPDKLDGAEAVSTTHPMGVFGTTALTFFLAEMGDKT
QVVTIALAARFHEFFGVVAGTTLGMMLANVPVIYLGHKFADRLPTKAVHILAAVIFVVLG
GFAL