Protein Info for BPHYT_RS10065 in Burkholderia phytofirmans PsJN

Annotation: cytochrome C oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00510: COX3
  • amino acids 31 to 201 (171 residues), 95 bits, E=3.5e-31

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 100% identity to bpy:Bphyt_2028)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• arsenite to oxygen electron transfer (1/2 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

See B2T4C4 at UniProt or InterPro

Protein Sequence (214 amino acids)

>BPHYT_RS10065 cytochrome C oxidase subunit I (Burkholderia phytofirmans PsJN)
MSDAADLSQTSAQPAEPLPIGSAGERSGGWWGCLTLIATEGALFGYLIFSYLYLASQSTQ
RWPPEGLPKLGLGITNTVILLSSSVFVWLCERCVRRRRLKWAVASMALGVLLGIVFVGIQ
LLEWHDHPYGLTTHLYGSLYFTITGFHMAHVVVGIVVLLFLLLWTALGYFDEKRCAALTI
GGLYWHFVDVVWLFIFSTLYLTPYLFRNLSWPAT