Protein Info for BPHYT_RS10035 in Burkholderia phytofirmans PsJN

Annotation: DSBA oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details amino acids 312 to 330 (19 residues), see Phobius details amino acids 341 to 358 (18 residues), see Phobius details amino acids 373 to 395 (23 residues), see Phobius details amino acids 409 to 421 (13 residues), see Phobius details amino acids 481 to 503 (23 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 20 to 502 (483 residues), 481.3 bits, see alignment E=1.7e-148 PF07690: MFS_1" amino acids 25 to 419 (395 residues), 177.5 bits, see alignment E=1.8e-56

Best Hits

Swiss-Prot: 50% identical to EMRB_ECO57: Multidrug export protein EmrB (emrB) from Escherichia coli O157:H7

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 100% identity to bpy:Bphyt_2022)

MetaCyc: 50% identical to multidrug efflux pump membrane subunit EmrB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4B8 at UniProt or InterPro

Protein Sequence (520 amino acids)

>BPHYT_RS10035 DSBA oxidoreductase (Burkholderia phytofirmans PsJN)
MNGSTQPATLPPLTGGKLVLATLAVALATFMNVLDSSIANVAIPTIAGNLGVSVDEGTWV
ITLFAAANAIAIPLTGWLVQRVGQIKLFVWAILLFVLSSWLCGIAPTLPVLLAARILQGA
VAGPLIPLSQAILLGSYPKEKSATALALWAMTATVGPIAGPALGGWITDSYSWSWIFYIN
IPVGLFAAGVTWAIYRTRETPTKRLPIDKVGLLSLIAWVGSLQIMLDKGKDLDWFNSPVI
IALTVFAAISFAFFVIWELTEKNPIVDLRLFGKRNFLGGTIAISVAYAVFFSNLVLLPQW
MQEYLNYRSVDAGLATAPLGIFAVILAPVMAKIMPKSDARVLATLAFVGFAGVFFMRSNY
TTGVDTWTLVLPTLLQGIPTALFFVPLTAIILSGLTPDRIPAAAGLSNFARVFAGAVGTS
LASTGWNDRTILHHSQLAEQTSVNNPTYTAALDALQSTLGGSHAQAMAFFERSMTTQAAM
LGLNDIFWLSAVIFVLIIPLIWVTKPDRSSSAAAAGAGGH