Protein Info for BPHYT_RS09995 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 340 to 361 (22 residues), see Phobius details amino acids 369 to 391 (23 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 390 (372 residues), 165.6 bits, see alignment E=7.6e-53

Best Hits

Swiss-Prot: 54% identical to TUB4_AGRVI: Putative tartrate transporter (ttuB) from Agrobacterium vitis

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2014)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4B0 at UniProt or InterPro

Protein Sequence (450 amino acids)

>BPHYT_RS09995 membrane protein (Burkholderia phytofirmans PsJN)
MDLEARTMKRVTVRLVPFLILCYFIAYLDRVNVGFAALQMNKALGLSASAFGFGAGIFFI
AYFFFEVPSNLLLEKFGARRWIARIMFTWGILAGAMAYIPDIARFTGLSAAHVFYGLRIL
LGVAEAGFFPGIIFLLTLWFPAAYRGRVVGYFMAAIPLSTVIGGPISGALLSMDGFAGLA
GWQWVYLIEAAPALVLAFVVLSYLTDKPADATWLAADERGWLVARQAQERAHREAVHTFS
VKEALFNPRVLAVALIYFGANATNYGLSFFLPQIVKSFGLTNLQTGFVTSLPYIVGVISM
VFWGRHSDRKLERKRHVAIALLVAAGGIAAAAGLDNPVQKMIALSIAGFGIFGCLPVIWT
LPASFLSGAAAAGGIAAVNSLGNLAGFFGPYAMGWIKDSTGGFGAGLLCLAGAGLVGVAA
VLLLHHDPSLEASAGGSDREVAGTGEAARS