Protein Info for BPHYT_RS09935 in Burkholderia phytofirmans PsJN

Annotation: trans-aconitate 2-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF13489: Methyltransf_23" amino acids 16 to 148 (133 residues), 60.4 bits, see alignment E=5.3e-20 PF13847: Methyltransf_31" amino acids 36 to 145 (110 residues), 51.7 bits, see alignment E=2.5e-17 PF13649: Methyltransf_25" amino acids 39 to 127 (89 residues), 59.3 bits, see alignment E=1.5e-19 PF08241: Methyltransf_11" amino acids 39 to 130 (92 residues), 53 bits, see alignment E=1.3e-17 PF08242: Methyltransf_12" amino acids 39 to 129 (91 residues), 59.9 bits, see alignment E=1e-19

Best Hits

Swiss-Prot: 55% identical to TAM_RHILO: Trans-aconitate 2-methyltransferase (tam) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K00598, trans-aconitate 2-methyltransferase [EC: 2.1.1.144] (inferred from 100% identity to bpy:Bphyt_2002)

Predicted SEED Role

"Trans-aconitate 2-methyltransferase (EC 2.1.1.144)" (EC 2.1.1.144)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.144

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T498 at UniProt or InterPro

Protein Sequence (258 amino acids)

>BPHYT_RS09935 trans-aconitate 2-methyltransferase (Burkholderia phytofirmans PsJN)
MTSNKDWHAKQYVLFESERTRPVRDLLAAVPPTDVKTAVDIGCGPGNSTETLAAHVPGAA
VSGMDSSPDMIAAARQRLPQFRFDVSDIATWDAPGPYDLILANAVLQWVPDHERLFPSLV
GKLTPGGSLAVQMPDNLDEPAHRLLREIAADGPWAHKLKGVERTMRYGAQWYYALLEPLC
ARVDVWRTVYHHPLAGGADAVVEWFKGSALRPFLAELDDAEQAAFLGRYREAIAAAYPAL
ADGTVLLPFPRLFIVATR