Protein Info for BPHYT_RS09910 in Burkholderia phytofirmans PsJN

Annotation: tyramine oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 661 transmembrane" amino acids 384 to 403 (20 residues), see Phobius details PF02727: Cu_amine_oxidN2" amino acids 14 to 98 (85 residues), 34 bits, see alignment E=4.3e-12 PF02728: Cu_amine_oxidN3" amino acids 109 to 213 (105 residues), 61.9 bits, see alignment E=9.3e-21 PF01179: Cu_amine_oxid" amino acids 235 to 637 (403 residues), 533.2 bits, see alignment E=6.7e-164

Best Hits

Swiss-Prot: 47% identical to PAOX_ARTGO: Phenylethylamine oxidase from Arthrobacter globiformis

KEGG orthology group: K00276, primary-amine oxidase [EC: 1.4.3.21] (inferred from 100% identity to bpy:Bphyt_1997)

Predicted SEED Role

"Monoamine oxidase (1.4.3.4)" in subsystem Aromatic Amin Catabolism or Auxin biosynthesis or Glycine and Serine Utilization or Threonine degradation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T496 at UniProt or InterPro

Protein Sequence (661 amino acids)

>BPHYT_RS09910 tyramine oxidase (Burkholderia phytofirmans PsJN)
MNTNATTAAHAPFHPLDPLSGAEMQLACDLVKAAEKLDSHARFPMVELREPPKAEVVAFK
TGEYFSRTAFVLAIDRTNGATIEFEVDLREKKIAARRVMPFGEAPYGQPPIMIDDFMNAE
QIVKSDEAWRVAVMKRGLSEKDLERVQVDPFSAGCFDRENENGRRLVRCVSYYRETLTDN
GYAHPIEGVMAVVDLLEKKVIELVDDGRIIPIPRAKHNYDTPSLGEPRSTLKPLSIDQPD
GPSFTIDGWHVNWQNWNFRVGFTPREGLVLHQLSWDDGKSTRPIIYRASVTEMCVPYSDP
TTNHYWKSAFDAGEYGLGKLANQLELGCDCLGTIRYFDIPSADDFGNPFVMKNAVCMHEE
DYGTLWKHYEFRTGVFEMRRSRRLVISFFATVGNYDYGFYWYLYQDGTIQLECKLTGIVQ
TSAVADGDTYPWGGMITENLGGPTHQHFFNARMHMMVDGERNTVTEHEFVPRPMGENNPY
GNVFDTTKRVLKTESEAARNANGSTGRYWKVSNPNVKNAVGANPGYKLVVNDSPLMLADE
RSKVRQRGGFATRHVWVTPFDPAERYASGDYPNQHSGGDGLPRYIEANRNIENEDVVLWH
SFGHTHVCKPEDFPVMPVEYAGFMLKPNNFFSANPTMDLPAERDLNSVEDGKSTDHGCCK
H