Protein Info for BPHYT_RS09865 in Burkholderia phytofirmans PsJN

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 137 to 154 (18 residues), see Phobius details PF02308: MgtC" amino acids 32 to 154 (123 residues), 122.8 bits, see alignment E=5.4e-40

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 100% identity to bpy:Bphyt_1988)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T484 at UniProt or InterPro

Protein Sequence (162 amino acids)

>BPHYT_RS09865 methyltransferase (Burkholderia phytofirmans PsJN)
MDNWWHAVWATARGEFSDLGSAADVTQVLMRLGLALILGGILGFEREMSRRDAGMRTHMM
VSVGAALFVVVPLQAGFSQDNMSRVLQGLVSGIGFLGAGAIIKLSAEREVRGLTTAAGLW
LTAGVGVAAGLGREATAILSVAIALAILSSARLFKSREQEEK