Protein Info for BPHYT_RS09855 in Burkholderia phytofirmans PsJN

Annotation: major facilitator superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 232 to 249 (18 residues), see Phobius details amino acids 261 to 285 (25 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 383 to 406 (24 residues), see Phobius details amino acids 414 to 435 (22 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 400 (382 residues), 100 bits, see alignment E=6.9e-33

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 100% identity to bpy:Bphyt_1986)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T482 at UniProt or InterPro

Protein Sequence (455 amino acids)

>BPHYT_RS09855 major facilitator superfamily protein (Burkholderia phytofirmans PsJN)
MKNVMSSLKSGDWRALVACFLYFDTGFTVWVLYGPLAPFISKSIAMTPAQQGLLVAVPVL
SAAILRVTLGNLYQSAHGKRIALMGVLLSAVPTIVLPLMPSVPSYTVLLVLGVFLGVGGA
SFAVALPMAGSNYPPKVQGLVLGLAAAGNIGAVLDGFLFPQLATHYGWQMAAGGALPLLA
IAAITLYFWANDSGVKTGSVLRAFGSFAVTLVGLIVLVLLVEAGMFGSGKTGVLLLPVIG
ALLAIAVLPKRYRAVLAERDTWAIMLVYSITFGGFVGMSSYVTLLLTNLYQLSKIDAGLF
MALLAATGAMVRPLGGLIADKVSGVRALTFLLAVISLCDFVFAAAMPAMAGGIALLLCLY
VAFGLGNGATFQLVPHRWAGRTGLMSGIVGAAGGIGGFYLPVVMGIAKESTGSYQMGFAT
FGALAACAFVAIVALRRPWMAWSMHTGVMHAHATE