Protein Info for BPHYT_RS09785 in Burkholderia phytofirmans PsJN

Annotation: glycosyl transferase family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 818 PF13439: Glyco_transf_4" amino acids 91 to 231 (141 residues), 30.6 bits, see alignment E=9.7e-11 amino acids 444 to 610 (167 residues), 51.4 bits, see alignment E=4e-17 PF00534: Glycos_transf_1" amino acids 238 to 373 (136 residues), 85.4 bits, see alignment E=1.1e-27 amino acids 623 to 790 (168 residues), 115.6 bits, see alignment E=5.5e-37 PF13692: Glyco_trans_1_4" amino acids 244 to 372 (129 residues), 70.7 bits, see alignment E=4.9e-23 amino acids 638 to 776 (139 residues), 78 bits, see alignment E=2.8e-25 PF13579: Glyco_trans_4_4" amino acids 444 to 608 (165 residues), 46.2 bits, see alignment E=1.9e-15 PF13524: Glyco_trans_1_2" amino acids 726 to 799 (74 residues), 25.9 bits, see alignment E=2.8e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1970)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T467 at UniProt or InterPro

Protein Sequence (818 amino acids)

>BPHYT_RS09785 glycosyl transferase family 1 (Burkholderia phytofirmans PsJN)
MNHEVLEEAVLQPATRSALAELTTVPGVQAPPRSAALRADKAVRIAIVHDWLVTYAGAEK
VLEQIVACFPDADLFSLVDFLDDRSFLRGKAVTTSFIQKLPLARTKYRSYLPLMPLAIEQ
LDVSAYDVVISSSHAVAKGILTGPDQVHISYVHSPIRYAWDLQHQYLKQSKLTNGPKSAM
ARLILHYMRNWDIRTSNAVDGFVANSEFIARRIKKVYQRDAQVIFPPVDVEAFALCTDKE
DFYLTASRMVPYKKIDLIVEAFARMPQRKLVVIGDGPDMQKIRAKAGPNVEIMGYQPFKM
LKEKMSRAKAFVFAAEEDFGISVVEAQACGTPVIAYGKGGALETVRDLSEPRPTGMFFDD
QNVESIIAAVERFDGHVKRFSPLDCRANAEQFSAAHFRERFFAHVRAAVPALRAATLPPY
VPYKAPTVASGPRILAVDQSGVLGGAELSLLEIVKALRSRIEVVLFDDGPFRSALAKAGV
AVDVLDAGALRHVRKQGGSMPKGQALKGLISLVRATAKRARNADVIYANTQRAMVIGALA
GKLARRPVVWHLRDIVSPEHFGGKQLAIIKWCARLGLTHVIANSAASARAFAELTQFDEK
RIDVVFNGISAAPFDALRTVPQATLRKRLGLPEDAFLVGSFSRLARWKGQHVLLEAMVLN
PQMHAVLVGAPLFGEDQYEIELHAFVAAHNLGGRVHFLGFQHDIAACMCAVDAVVHTSIT
PEPFGRVIVEGMLAQRPVVAARAGGVLEIIDDYENGVLCTPADAHGLADALAELRSNDEL
RNRLVRNGYQTALSRFGTATYVEGVERILKRVTGPKTA