Protein Info for BPHYT_RS09750 in Burkholderia phytofirmans PsJN

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF13439: Glyco_transf_4" amino acids 14 to 185 (172 residues), 89.5 bits, see alignment E=8e-29 PF13579: Glyco_trans_4_4" amino acids 15 to 181 (167 residues), 44.9 bits, see alignment E=4.8e-15 PF20706: GT4-conflict" amino acids 146 to 365 (220 residues), 28.5 bits, see alignment E=2.4e-10 PF00534: Glycos_transf_1" amino acids 193 to 351 (159 residues), 95.9 bits, see alignment E=6.2e-31 PF13692: Glyco_trans_1_4" amino acids 205 to 340 (136 residues), 97.4 bits, see alignment E=2.8e-31 PF13524: Glyco_trans_1_2" amino acids 280 to 368 (89 residues), 32.9 bits, see alignment E=1.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1963)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T460 at UniProt or InterPro

Protein Sequence (409 amino acids)

>BPHYT_RS09750 glycosyl transferase (Burkholderia phytofirmans PsJN)
MRVAIVTHVVRHNDGQGRVNHEIARAALDENIGVTLIASHVAPDLLAHPNVRWAPIKIGR
WWPTNLLRQQVFAFKSALWLRAHRREYDVLHVNGFITWMPADVNTSHFVHSGWFGSKYYP
FGLTKGVWSAYQSVYTRCNALLERWAYRRSKVITAVSQKVADEIRAIGLTSDNRVDVIYN
GVDTQGFAAATGDREKFGLPKDAFLLLFVGDLRTPRKNLGTVLAALKHLPEHVQIAVAGF
LPGSPYPEEAKALGIAHRVHFLGLVKEMPVLMHSVDAFVFPSRYEAMSLSLLEAMAAGLP
VVTARTAGGAEIITPECGIVLDDPDDPKALASAVARLADNHVARRAMGVAANELATGFGW
ARMAEQYIALYRQLAGQQKDRRRSEAEAAAVAKTDALTLNTLAGQKSAE