Protein Info for BPHYT_RS09745 in Burkholderia phytofirmans PsJN

Annotation: glucose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 30 to 56 (27 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 154 to 154 (1 residues), see Phobius details amino acids 158 to 173 (16 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 264 to 292 (29 residues), see Phobius details amino acids 302 to 324 (23 residues), see Phobius details amino acids 398 to 423 (26 residues), see Phobius details amino acids 431 to 449 (19 residues), see Phobius details amino acids 453 to 473 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1962)

Predicted SEED Role

"Putative transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T459 at UniProt or InterPro

Protein Sequence (493 amino acids)

>BPHYT_RS09745 glucose-6-phosphate isomerase (Burkholderia phytofirmans PsJN)
MSTLTRSAASANGTARAPSSSRKEWLPEALLWFVTTLLIGAHQGTVLTLAFPVLAILTGL
WLYFKSPARYIGFMWWLWFLSPEVRRLADWSKGSFTPTSLIQVAPLAVTMISGLSLLRYY
KLLAQRRGLPVLLVLLGLIYAFLVGVMSSGPLAATYDLANWLYPILIGFHIMAHTRQYPK
YRDTIVNTFIWGMLVMGGYGLVQFFIMPQWDALWMLGSQMNSQGDPVPMGVRVFSTMNSS
GPFAFAMMGAMVFVMAATHRVRWIAAALGFFAFALSLVRSTWGGWVIALLIQLVKSNNKV
RVRIVASAVLLAGLCVPLLAVGPVAERMQARLTTIVNLNDDQSYAARNEFYATFAKTAFT
DVSGEGMGATGTSTKLSNDGGQLGQYGNFDSGVMNIPFVLGWPGTLLYMSGIIWLVTRAV
LASFKLRNDKFVSACMSLSLATFAMLVFTNSLVGTGGLLLFMSVFSILSAVHYEKINRAR
MSNHTLSFHGGTD