Protein Info for BPHYT_RS09655 in Burkholderia phytofirmans PsJN

Annotation: mechanosensitive ion channel protein MscS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 189 to 255 (67 residues), 47.6 bits, see alignment E=7.2e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1945)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T442 at UniProt or InterPro

Protein Sequence (407 amino acids)

>BPHYT_RS09655 mechanosensitive ion channel protein MscS (Burkholderia phytofirmans PsJN)
MPTLDDLSRMAEAPLHTWPGALIVSVIAMMLAVGIHQIGARIVTRLARPYPLTSVVLRYI
DKPSLFVLVILALEAVWWEAPDTLTFITPLRDAAAITLIGGITWLSVRSAAAIGEAIIQA
HPLDTADNLQARRIHTQARVLARSVMFVIVIVGVGGALMTFPSVRQIGASLLASAGVAGL
VAGIAARPVLGNLIAGLQIALSQPIRLDDVVVIQGEWGRIEEITGTYVSVRLWDQRRLIV
PLQWFIENPFSNWTRSSSQIIGTVFLYVDYRMPLAPLREELARIVEDAPEWDRRVQVLQV
TDGTERSMQLRALVSSLDSGLNWDLRCRVREGLLDFIQQHYPQYLPRARAEVSAELETGK
GEPLDWVPRSTQTPAGSTAAHTEADPVATRAGRQPAVGVPGQAKEKV