Protein Info for BPHYT_RS09635 in Burkholderia phytofirmans PsJN

Annotation: phosphinothricin acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 transmembrane" amino acids 105 to 127 (23 residues), see Phobius details PF13302: Acetyltransf_3" amino acids 5 to 141 (137 residues), 43.2 bits, see alignment E=9.9e-15 PF00583: Acetyltransf_1" amino acids 48 to 141 (94 residues), 52 bits, see alignment E=1.3e-17 PF13508: Acetyltransf_7" amino acids 55 to 141 (87 residues), 31.5 bits, see alignment E=2.9e-11

Best Hits

Swiss-Prot: 54% identical to YWNH_BACSU: Putative phosphinothricin acetyltransferase YwnH (ywnH) from Bacillus subtilis (strain 168)

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 100% identity to bpy:Bphyt_1941)

Predicted SEED Role

"Sortase and related acyltransferases"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.183

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T438 at UniProt or InterPro

Protein Sequence (174 amino acids)

>BPHYT_RS09635 phosphinothricin acetyltransferase (Burkholderia phytofirmans PsJN)
MSLSYRDATLDDLPAIVAIYNSTVPSRQVTADLDPVSVESRMGWFHAHGPQKRPLWVVEA
TEQPGRVIAWLSFSDFYGRPAYQRTAEVSIYLDESARGRGLGKQLLAASLAAAPALGIDS
VLGFIFGHNEASLRLFRGFGFDTWGSLPRVAVLDGVERDLVILGKRLDSAAAAA