Protein Info for BPHYT_RS09555 in Burkholderia phytofirmans PsJN

Annotation: long-chain fatty acid--CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 PF00501: AMP-binding" amino acids 23 to 403 (381 residues), 254.6 bits, see alignment E=1.5e-79 PF13193: AMP-binding_C" amino acids 451 to 525 (75 residues), 66.7 bits, see alignment E=2.8e-22

Best Hits

Swiss-Prot: 53% identical to DMDB_RUEPO: 3-methylmercaptopropionyl-CoA ligase (dmdB) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00666, fatty-acyl-CoA synthase [EC: 6.2.1.-] (inferred from 100% identity to bpy:Bphyt_1925)

MetaCyc: 53% identical to 3-methylmercaptopropionyl-CoA ligase (Ruegeria pomeroyi DSS-3)
RXN-12571 [EC: 6.2.1.44]

Predicted SEED Role

"Medium-chain-fatty-acid--CoA ligase (EC 6.2.1.-)" (EC 6.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-

Use Curated BLAST to search for 6.2.1.- or 6.2.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T422 at UniProt or InterPro

Protein Sequence (561 amino acids)

>BPHYT_RS09555 long-chain fatty acid--CoA ligase (Burkholderia phytofirmans PsJN)
MTTPLLGQMMDVPLTVPSLLTHAARHFGSTEIVSRRIEGDLHRYTYRDCEKRAKQLAQAL
IALGVEPGERVATLAWNGYRHLEAYYGTTGFGAVCHTINPRLFPDQIAYIINHADDAYVL
FDTTFAPLVDVLAPQCPKVRGWIALADEAHLPAMQTPALSYETLVTAQDGNYAWPPLDER
QASYLCYTSGTTGNPKGALYSHRSTVLHAFGASLPDAMSLSARDCVLPVVPMFHVNAWGI
PHAAPLTGAKLVFPGKDLDGKSLYELMESERVTYSAGVPTVWLGLLNYLREAKVRFSSLN
RTVIGGSACPPAMLRTFEDDYGVQVIHAWGMTEMSPLGTLSKLTWEQSQRPLEEQRALLE
KQGHVLYGVDMKIVGEDGRELPWDGVAFGDLHVRGPWVIDRYFRKDDSPLVDGWFPTGDV
ATIDRDSFLHITDRSKDVIKSGGEWISSIDVENVAIAHPAVAEAACIACAHPKWTERPLL
VVVKRPGFEVTREELIAFYDGKVAKWWIPDDVAFVDELPHTATGKLQKLKLRDIFRNHVL
PSALEDEKDCPLTPLARGNPA