Protein Info for BPHYT_RS09525 in Burkholderia phytofirmans PsJN

Annotation: toxin HipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 TIGR03071: HipA N-terminal domain" amino acids 6 to 107 (102 residues), 69.7 bits, see alignment E=9.8e-24 PF13657: Couple_hipA" amino acids 8 to 107 (100 residues), 84.2 bits, see alignment E=8.1e-28 PF07804: HipA_C" amino acids 147 to 389 (243 residues), 166.9 bits, see alignment E=5.4e-53

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1919)

Predicted SEED Role

"Protein hipA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T416 at UniProt or InterPro

Protein Sequence (430 amino acids)

>BPHYT_RS09525 toxin HipA (Burkholderia phytofirmans PsJN)
MAARALVAYANGRRVGVVSDDSGVWSFAYAEDWLAREDAFALSPAFPLLAEPFADGSSRR
PVQWFFDNLLPEEEMRSALAREAKVDASDAWGLLAYYGRESAGALTLLAEGEQEAPGGLQ
SLSRANLEARIQAMPQHALTATAPKRMSAAGAQQKLLLTLRGNAPDYELLEPVGSEPSMH
LLKPDMRSTGYPHSAINEFFCMQLARAMGVRVPPTHFLRVPSACYVIDRFDRDTSSEPAG
RLHTVDAMQLLNYDRSFKYRNATAQVLRDAIEKTSTRAVARLDVFRWAIFNVLIGNADSH
LKNLSFFVTARGYRLAPFYDLVSTVVYHTPTYQPQQRDRWPHCDLTMPVGDATQFAQINR
KNMLAFGEALRLSPKGSERLLDEMLATLDARVADTRRSVDEIAQPNAGEVRLLDSIVAMP
LAEMSRALRK