Protein Info for BPHYT_RS09465 in Burkholderia phytofirmans PsJN

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 PF00216: Bac_DNA_binding" amino acids 1 to 90 (90 residues), 118 bits, see alignment E=1.7e-38 PF18291: HU-HIG" amino acids 2 to 89 (88 residues), 35.8 bits, see alignment E=7.6e-13

Best Hits

Swiss-Prot: 71% identical to DBHB_PSEAE: DNA-binding protein HU-beta (hupB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03530, DNA-binding protein HU-beta (inferred from 94% identity to bgf:BC1003_1604)

Predicted SEED Role

"DNA-binding protein HU-beta" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T406 at UniProt or InterPro

Protein Sequence (90 amino acids)

>BPHYT_RS09465 transcriptional regulator (Burkholderia phytofirmans PsJN)
MNKTELIDHVAQQADISKAAAGRALDAVIDGVKGTLKKGGSVTLVGFGTFAVGKRTARTG
RNPRTGAAIKIKAAKVPKFRPGKALKDALN