Protein Info for BPHYT_RS09445 in Burkholderia phytofirmans PsJN

Annotation: trigger factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF05697: Trigger_N" amino acids 2 to 142 (141 residues), 129.3 bits, see alignment E=2.2e-41 TIGR00115: trigger factor" amino acids 11 to 426 (416 residues), 423.4 bits, see alignment E=4.4e-131 PF00254: FKBP_C" amino acids 166 to 248 (83 residues), 60.6 bits, see alignment E=2.2e-20 PF05698: Trigger_C" amino acids 274 to 426 (153 residues), 126.4 bits, see alignment E=1.7e-40

Best Hits

Swiss-Prot: 100% identical to TIG_PARPJ: Trigger factor (tig) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K03545, trigger factor (inferred from 100% identity to bpy:Bphyt_1905)

Predicted SEED Role

"Cell division trigger factor (EC 5.2.1.8)" in subsystem Bacterial Cell Division (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3Z9 at UniProt or InterPro

Protein Sequence (448 amino acids)

>BPHYT_RS09445 trigger factor (Burkholderia phytofirmans PsJN)
MANVVENLGKLERRVTISLPKDAVQKEVDSRIRQLAKNVRMPGFRPGKVPLKMVTQQYSG
QVEAEVLSDKVGKEFFDISRSENLRVAGQPSFAPKSDATEGDYAFDATFEVYPEVKLGDV
ATAEIERTTTTISEAEIDRTLDILRKQRVHFHARGEAGEHGDGGGDTAAKEGDRVTVDFV
GKIEGEVFQGGSADDFAFVLGEGRMLPEFEKAATGLKVGESKEFDLAFPEDYHGKDVAGK
TAQFTITMKKIEWPHLPEIDAEFAKSLGIEDGDLTKMRAEIKDNLEREAKRRTQAIVKNQ
VMDALLKISELDVPNALIEQDQERLVAMARQDLEQRGVPNAKDAPIPAAMFKEQAERRVK
LGLVLAELVKANELQAKPEQIRAEVDEFAKSYEDPKEVVRWYYSNQQRLAEMEAYVVEAN
VVDFVLSKAKVTDKEVSFEELASATAQA