Protein Info for BPHYT_RS09375 in Burkholderia phytofirmans PsJN

Annotation: (2Fe-2S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 PF01494: FAD_binding_3" amino acids 10 to 51 (42 residues), 25 bits, see alignment 5.4e-09 PF00890: FAD_binding_2" amino acids 11 to 88 (78 residues), 34.4 bits, see alignment E=7.4e-12 PF07992: Pyr_redox_2" amino acids 11 to 131 (121 residues), 52.3 bits, see alignment E=2.9e-17 PF01134: GIDA" amino acids 11 to 41 (31 residues), 26.3 bits, see alignment (E = 1.9e-09) PF12831: FAD_oxidored" amino acids 11 to 58 (48 residues), 39.8 bits, see alignment 1.8e-13 PF13450: NAD_binding_8" amino acids 14 to 50 (37 residues), 31.4 bits, see alignment 9.4e-11 PF17806: SO_alpha_A3" amino acids 388 to 467 (80 residues), 31.4 bits, see alignment E=9.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1891)

Predicted SEED Role

"Sarcosine oxidase alpha subunit (EC 1.5.3.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.5.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3Y8 at UniProt or InterPro

Protein Sequence (468 amino acids)

>BPHYT_RS09375 (2Fe-2S)-binding protein (Burkholderia phytofirmans PsJN)
MTADFASEAVDVVVVGAGPAGMSAATRAARAGLSTVLIDEQDAAGGQIYRAIGRADARRK
EILGPDYAAGAAIAEAFAASGARHLTHATVWQVTRERGVNYLKDGKIGSFDAQRVILASG
ALERPFPIPGWTLPGVLTAGAAQILLKSAGEVPAAPPVLAGCGPLLYLLGWQYVRAGVPI
RALVDTTRHEDRWRAKRHMLAALRAWPFLSKGLQLIRTLRDAKVPIFEAADDLRVESRIG
TDHVERAAALHFTTQGTAHRLEADVILLHQGVVPNTQFTQALRAAHRWDDAQLCFTPKVD
AWGELDVPGIFVAGDGAGIGGAQAAALQGTLAGLAAAAQLGALTAEARDAEAVAQRRALA
GVMRIRPFLDSLYRPRDINRIPRDETIVCRCEEVTAGELRKFVELGCVGPNQAKSFGRCG
MGPCQGRMCGLTVTEVIADARRVSPAEVGYYRIRPPIKPLTLGELAGE