Protein Info for BPHYT_RS09310 in Burkholderia phytofirmans PsJN

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 50 to 65 (16 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details PF16524: RisS_PPD" amino acids 47 to 152 (106 residues), 135.4 bits, see alignment E=1.4e-43 PF00512: HisKA" amino acids 235 to 289 (55 residues), 38.7 bits, see alignment 1.3e-13 PF02518: HATPase_c" amino acids 332 to 446 (115 residues), 78.7 bits, see alignment E=6.9e-26

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 100% identity to bxe:Bxe_A2308)

Predicted SEED Role

"Osmolarity sensory histidine kinase EnvZ"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3X5 at UniProt or InterPro

Protein Sequence (449 amino acids)

>BPHYT_RS09310 sensor histidine kinase (Burkholderia phytofirmans PsJN)
MRIDRRLLTLAFGGLFWRTFLLIALLIAVSLAAWFQSFRVIEREPRAQRVALQLVAIVKL
TRTALLYSDPDLRRALLQDLESNEGVRVYPRETTDKYKLQPDESLNRLIEHDIRGRLGDD
TVIAQSVNDIPGVWISFKIDDDDYWVALDRDQLDNATGLQWAGWGVFALALSLFGAAFIT
SLVNRPFARLAMAARKVGSGQSPEPLPERGMGVAAETNRSFNQMVQDLEQLEADRALMLA
GISHDLRTPLARLRLETEMSPSDQATKDAMVDDIEQMDMIIGRFLDYARPVQRVPEPVDL
SVIAGELAARMQSEDSMRLITRLAPSAVIEADETDMRRVVGNLLENARKYGLSDGDGIPH
VILETRVSHSRVELSVVDEGPGIPEDQLALVTRPFYRVNSARTQANGTGLGMAIVQRLVS
RYRGALRLRNRTPGPGLEVTIEFPLAKGV