Protein Info for BPHYT_RS09115 in Burkholderia phytofirmans PsJN

Annotation: RNA polymerase sigma factor RpoS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 TIGR02394: RNA polymerase sigma factor RpoS" amino acids 71 to 359 (289 residues), 461.3 bits, see alignment E=1.4e-142 PF00140: Sigma70_r1_2" amino acids 80 to 113 (34 residues), 31.3 bits, see alignment 3.3e-11 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 113 to 347 (235 residues), 114.3 bits, see alignment E=4.3e-37 PF04542: Sigma70_r2" amino acids 118 to 187 (70 residues), 77 bits, see alignment E=1.6e-25 PF04539: Sigma70_r3" amino acids 198 to 279 (82 residues), 25.9 bits, see alignment E=1.8e-09 PF04545: Sigma70_r4" amino acids 294 to 346 (53 residues), 61.4 bits, see alignment 9e-21

Best Hits

KEGG orthology group: K03087, RNA polymerase nonessential primary-like sigma factor (inferred from 100% identity to bpy:Bphyt_1837)

Predicted SEED Role

"RNA polymerase sigma factor RpoS" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3T4 at UniProt or InterPro

Protein Sequence (360 amino acids)

>BPHYT_RS09115 RNA polymerase sigma factor RpoS (Burkholderia phytofirmans PsJN)
MPKSKRRPPQAESEKTSNAMSASVDESGASEVEEEIAEERDLDERQGGADEAGETRESAS
EAAPDADDFRALLQAELTADTIQHYLNRISVKPLLTVEEEQKYSRLAKAGEFEARQVMIE
RNLRLVVSIAKGYLNRGVPLLDLIEEGNLGLMHAIEKFDPTRGFRFSTYATWWIRQSIER
AIMNQARTVRLPVHVIRELNQVLRAKRHLEKNSMNSGEAAERRDASIDDIAYLTGKTTDE
VTDILALNEHTASLDAPLDLDPASSLLDLLSDDQSQSPDAEVQHRELETLTRAWLARLSD
KHRHVIERRFGLNHIEPATLEELADEMGLTRERVRQIQQEALVRLKRFFASNGVRKDAVL