Protein Info for BPHYT_RS09105 in Burkholderia phytofirmans PsJN

Annotation: protein-L-isoaspartate O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 140 to 348 (209 residues), 198.3 bits, see alignment E=7e-63 PF01135: PCMT" amino acids 144 to 347 (204 residues), 192.3 bits, see alignment E=4.8e-61

Best Hits

Swiss-Prot: 73% identical to PIMT_PARP8: Protein-L-isoaspartate O-methyltransferase (pcm) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 100% identity to bpy:Bphyt_1835)

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3T2 at UniProt or InterPro

Protein Sequence (350 amino acids)

>BPHYT_RS09105 protein-L-isoaspartate O-methyltransferase (Burkholderia phytofirmans PsJN)
MTSERAKRFPLGLEDLVREPRRPEGRPGEIRAAALAASAALNARQQPAKNAPPGSAGKSQ
SRPARAQTAAQIKPQAKPSAATPPKPVAAPSIKTPAKPVVQSSTTRSAAQPSASAKPVAR
SSERGAAPNVALNGAMALTSERVRERMVERLRANGVTDQRVLNAMSVVPRHMFVDPGLAV
QAYEDAALPIGHHQTISKPSVVARMIELAAAGRALTNVLEIGTGCGYQAAVLSQVAREVY
SIERIKPLSERAKTNLRPLRIPNIRLHYGDGRLGLPAAAPFDAIVIAAAGLDVPQALLEQ
LAIGGRLVAPVGSQDGQNQVLTLVERLGPAQWRESRLDRVFFVPLKSGVI