Protein Info for BPHYT_RS09090 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 74 to 101 (28 residues), see Phobius details amino acids 121 to 159 (39 residues), see Phobius details amino acids 180 to 209 (30 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 92 to 262 (171 residues), 91.4 bits, see alignment E=3e-30

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to bpy:Bphyt_1832)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, permease component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3S9 at UniProt or InterPro

Protein Sequence (274 amino acids)

>BPHYT_RS09090 ABC transporter permease (Burkholderia phytofirmans PsJN)
MWKTLRPNRANLVIWQWLLLVLCFVLWYVLTSPTLLPPFYFDDPNKAAFFFGEPQKVLQR
IWEWFVGGEIYLHLWITLVETVLAFALGTALGLGVGLWLALSPLASALFDPYIKAANSMP
RVILAPIFGVWFGLGIWSKVALGVTLVFFIVFFNVYQGVKEVSPVVLANARMLGANGKHL
LRFVYLPSAMSWVFSSLHTSVGLAFVGSVVGEYLGSARGVGYLILQAEGTFDINTVFAGI
LVLTAFALILDAIVGIGERRLMKWQPKTGDTEKL