Protein Info for BPHYT_RS09015 in Burkholderia phytofirmans PsJN

Annotation: multidrug transporter MatE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 88 to 105 (18 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 196 to 221 (26 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 276 to 299 (24 residues), see Phobius details amino acids 314 to 336 (23 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details amino acids 380 to 402 (23 residues), see Phobius details amino acids 420 to 439 (20 residues), see Phobius details PF01554: MatE" amino acids 14 to 172 (159 residues), 101.5 bits, see alignment E=2.1e-33 amino acids 240 to 400 (161 residues), 93.4 bits, see alignment E=6.5e-31 TIGR00797: MATE efflux family protein" amino acids 14 to 407 (394 residues), 246.4 bits, see alignment E=2.4e-77

Best Hits

Swiss-Prot: 40% identical to NORM_AROAE: Probable multidrug resistance protein NorM (norM) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 100% identity to bpy:Bphyt_1818)

Predicted SEED Role

"Multidrug and toxin extrusion (MATE) family efflux pump YdhE/NorM, homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3R5 at UniProt or InterPro

Protein Sequence (459 amino acids)

>BPHYT_RS09015 multidrug transporter MatE (Burkholderia phytofirmans PsJN)
MFADVRKIAGLAWPVLIGQLAIIAFGVIDTAMVGRYSAVDLAALGLGSSIYISVYIGLTG
ILTALQPITAQLYGARRYIEIGEEVRQALWLALALTVIGFLILFFPGPVLQVARVPEALH
ERTVAYLRILAFGLPAGLAFRVYSSVTNAVGKPRLVMILQIGALLLKVPLNTWFIFGGFG
VPALGGPGCALASTMINWALAALGMLLLTRVEVFMPFAIFSQFCWPVWRRQAAQLRLGIP
MGLSYLIEVTSYTFMALFIARFGTTTLAGHQIAGNIGAVLYMTPLSIGIASSTLVAQALG
AHRPEAARTLSRHGIMMAMAIACCYGAIVLVLRPYIIEGYTPNAQVVTAALPLVLIVVCY
HLFDALQITTAFVLRAYKVAVVPTVIYAVALWGVGLGGGYVLGFNVTGGTPEWLTGARGF
WVANTASLAIAGVGLLMYWRVVSKRYLRAEAALQVDSAA