Protein Info for BPHYT_RS08930 in Burkholderia phytofirmans PsJN
Annotation: aminotransferase DegT
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 40% identical to ARNB_PSEA8: UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (arnB) from Pseudomonas aeruginosa (strain LESB58)
KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1801)Predicted SEED Role
"UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (EC 2.6.1.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.6.1.-)
KEGG Metabolic Maps
- Aminophosphonate metabolism
- Arginine and proline metabolism
- Caprolactam degradation
- Lysine biosynthesis
- Lysine degradation
- Methionine metabolism
- Nucleotide sugars metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.6.1.-
Use Curated BLAST to search for 2.6.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2T3Q1 at UniProt or InterPro
Protein Sequence (383 amino acids)
>BPHYT_RS08930 aminotransferase DegT (Burkholderia phytofirmans PsJN) MTQSTVPFLPFVKPEIDEETIQGVADVLRSGWITTGPQNQKFEAALSEFCGGRPVRTFNS GTATLEIGLRIAGVGEGDEVITTPASWVSTSNVIYEVGATPVFADIDPVTRNIDLDLLEK AITPRTKALIPVYLSGLPVDMDRLYAIARAHKLRVIEDAAQAFGSTWKGERIGKLGDMVS FSFHANKNLTSIEGGALVLNNEEEAILAQKYRLQGITRTGFDGMDCDVLGGKYNLTDVAA CVGLGQLPHLARFLAQRRKLVRAYFAGFEGGAAAKLGVGLPFADYENSNWHMFQITLPLD KLSIDRAGFMGQLKERGIGSGVHYPAIHLFSLYRARGFKEGMFPHAEKFGATNVTLPLFT LMNEGDVERVCRAVNEICEQYGK