Protein Info for BPHYT_RS08800 in Burkholderia phytofirmans PsJN

Annotation: sulfate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 transmembrane" amino acids 37 to 65 (29 residues), see Phobius details amino acids 85 to 111 (27 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 222 to 248 (27 residues), see Phobius details amino acids 268 to 291 (24 residues), see Phobius details TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 38 to 295 (258 residues), 416.1 bits, see alignment E=6e-129 TIGR00969: sulfate ABC transporter, permease protein" amino acids 39 to 290 (252 residues), 331.5 bits, see alignment E=4.1e-103 PF00528: BPD_transp_1" amino acids 104 to 292 (189 residues), 51.2 bits, see alignment E=6.6e-18

Best Hits

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 100% identity to bpy:Bphyt_1775)

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3M2 at UniProt or InterPro

Protein Sequence (350 amino acids)

>BPHYT_RS08800 sulfate ABC transporter permease (Burkholderia phytofirmans PsJN)
MSRDSVKNAGAAAAVAVAPRAPLNVARRPDPVTEPPVVRWILTGVALLFLALFLVVPLAA
VFYQALNKGLGFYLESLADPDALSAIKLTVITAAIAVPLNLVFGLAASWCIAKFEFRGKA
LLTTLIDLPFSVSPVISGLIYVLMFGAQGWFGPWLQDHNVQIIFAVPGIVMATIFVTFPF
VARELIPLMQAQGNDEEEAAHVLGASGWQIFRRVTLPNVKWGLLYGVILCNARAMGEFGA
VSVVSGHIRGQTDTMPLHVEILYNEYNFSAAFAVASVLALLALVTLGLKLLAERHMSAEL
SAARDVPAYAGPVTPPDSAKPATPATPATHTQAMQATHASQQHPLKQGEL