Protein Info for BPHYT_RS08720 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details PF03458: Gly_transporter" amino acids 11 to 85 (75 residues), 74 bits, see alignment E=3.5e-25 amino acids 98 to 171 (74 residues), 80 bits, see alignment E=4.8e-27

Best Hits

Swiss-Prot: 42% identical to YADS_AERCA: UPF0126 membrane protein (yadS) from Aeromonas caviae

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1759)

Predicted SEED Role

"FIG00967038: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3K6 at UniProt or InterPro

Protein Sequence (208 amino acids)

>BPHYT_RS08720 membrane protein (Burkholderia phytofirmans PsJN)
MRLNVETLVLAADLAGTVVFALEGALSAIHGGLDLLGVMVIAFVAALGGGVIRDLLIGDS
PPNAIRDWRYPALTFITGLLTFIFHSTAQQFPVALVTVLDAAGLALFAVAGVEKALLFGI
RPFIAMLMGTVTGVGGGVIRDVLLARVPLVLHADIYATAAFAGAFIVVVARRAGLPPGAA
ALAGGSACFVLRVLAVTYGWHLPKVAPV