Protein Info for BPHYT_RS08715 in Burkholderia phytofirmans PsJN

Annotation: adenylyl-sulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 67 to 87 (21 residues), see Phobius details TIGR00455: adenylyl-sulfate kinase" amino acids 4 to 170 (167 residues), 224.4 bits, see alignment E=4.4e-71 PF01583: APS_kinase" amino acids 5 to 157 (153 residues), 214.2 bits, see alignment E=9.5e-68 PF13671: AAA_33" amino acids 8 to 122 (115 residues), 42 bits, see alignment E=1.1e-14

Best Hits

Swiss-Prot: 100% identical to CYSC_PARPJ: Adenylyl-sulfate kinase (cysC) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 100% identity to bpy:Bphyt_1758)

MetaCyc: 50% identical to adenylyl-sulfate kinase (Escherichia coli K-12 substr. MG1655)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3K5 at UniProt or InterPro

Protein Sequence (179 amino acids)

>BPHYT_RS08715 adenylyl-sulfate kinase (Burkholderia phytofirmans PsJN)
MSASRGAVIWMTGLSGAGKSTLANALHQRLMEAGHAAIVLDGDVLRRGLNADLGFTPEDR
TENLRRIAHVAALFMQQGFVVIAAVISPEHRHRCSAREIVGDGFIEVFVNAPLNVCEARD
AKGLYARARRGEIPHFTGISGPFEAPLAPDVVIESDRMPVDESVDRLLAHLAAMGRPGH