Protein Info for BPHYT_RS08715 in Burkholderia phytofirmans PsJN

Annotation: adenylyl-sulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00455: adenylyl-sulfate kinase
  • amino acids 4 to 170 (167 residues), 224.4 bits, E=4.4e-71
• PF01583: APS_kinase
  • amino acids 5 to 157 (153 residues), 214.2 bits, E=9.5e-68
• PF13671: AAA_33
  • amino acids 8 to 122 (115 residues), 42 bits, E=1.1e-14

Best Hits

Swiss-Prot: 100% identical to CYSC_PARPJ: Adenylyl-sulfate kinase (cysC) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 100% identity to bpy:Bphyt_1758)

MetaCyc: 50% identical to adenylyl-sulfate kinase (Escherichia coli K-12 substr. MG1655)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

See B2T3K5 at UniProt or InterPro

Protein Sequence (179 amino acids)

>BPHYT_RS08715 adenylyl-sulfate kinase (Burkholderia phytofirmans PsJN)
MSASRGAVIWMTGLSGAGKSTLANALHQRLMEAGHAAIVLDGDVLRRGLNADLGFTPEDR
TENLRRIAHVAALFMQQGFVVIAAVISPEHRHRCSAREIVGDGFIEVFVNAPLNVCEARD
AKGLYARARRGEIPHFTGISGPFEAPLAPDVVIESDRMPVDESVDRLLAHLAAMGRPGH