Protein Info for BPHYT_RS08485 in Burkholderia phytofirmans PsJN

Annotation: undecaprenyl-phosphate glucose phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 438 to 460 (23 residues), see Phobius details TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 8 to 465 (458 residues), 505.3 bits, see alignment E=2.2e-155 TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 9 to 464 (456 residues), 457.8 bits, see alignment E=5.3e-141 PF13727: CoA_binding_3" amino acids 53 to 238 (186 residues), 177.9 bits, see alignment E=2e-56 PF02397: Bac_transf" amino acids 274 to 458 (185 residues), 225 bits, see alignment E=5.2e-71

Best Hits

KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 100% identity to bpy:Bphyt_1713)

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.6

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3G0 at UniProt or InterPro

Protein Sequence (465 amino acids)

>BPHYT_RS08485 undecaprenyl-phosphate glucose phosphotransferase (Burkholderia phytofirmans PsJN)
MFRNTARFLDVLFVIAGGLLAHWMRFSTPIALSDTERLLIAFNCVLLLLLFPGFGVYETW
RGKPLPAMLARVAAAWLVVVFTALVLAFTLHRMDAVSRLWFGYSTVISGALIIVTKCLVH
AVLRMVRRRGMNSRTVAIVGAPGFARTLLAHLEHAPQAGFKPVCVLDTSCHTSFEAAEPY
GARLNRLPVLTDLNAFAAKVREDHVNEVWLALPLSEEHTIYRFTRMFRHDFVNLRFIPDV
RSLSLFNHALVDVVGLPTLNLSATPFSSPQMWPKLIFDRLFAAAALLALAPVFVALAIGI
KLGSPGPVFFRQTRKGVDGQPFAIYKFRSMTVHHEAQGQLTQASRNDARVTKLGGFMRRT
SLDELPQFLNVLLGQMSVVGPRPHAVEHDDLYKDQVYGYMHRYRIKPGITGWAQVNGYRG
ATTKVEKMEARVKFDLFYIHNWSFWFDMKIVFITIFKGFVGRNAF