Protein Info for BPHYT_RS08465 in Burkholderia phytofirmans PsJN

Annotation: ribose-5-phosphate isomerase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 TIGR00021: ribose 5-phosphate isomerase A" amino acids 10 to 223 (214 residues), 215.3 bits, see alignment E=3.5e-68 PF06026: Rib_5-P_isom_A" amino acids 53 to 221 (169 residues), 196.4 bits, see alignment E=1.5e-62

Best Hits

Swiss-Prot: 100% identical to RPIA_PARPJ: Ribose-5-phosphate isomerase A (rpiA) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 100% identity to bpy:Bphyt_1709)

MetaCyc: 61% identical to ribose-5-phosphate isomerase A (Escherichia coli K-12 substr. MG1655)
Ribose-5-phosphate isomerase. [EC: 5.3.1.6]

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3F4 at UniProt or InterPro

Protein Sequence (231 amino acids)

>BPHYT_RS08465 ribose-5-phosphate isomerase A (Burkholderia phytofirmans PsJN)
MTQDELKQLVGQAAADYVNATVPEGAVIGVGTGSTANCFIDALAGNKARYRGAVSSSLAT
TARLQTHGIKVFDLNEIDSLPVYVDGADEIDRSGAMIKGGGGALTREKIVASVSDVFVCI
ADASKLVETLGTFPLPIEVVPMARTAIGRRVTALGGVPVVRVTKEGVPFITDNGNEIIDV
KGLRISDPRTLETHINAWPGVVTVGLFAARGANLCLLGTDTGVETIEYSKG