Protein Info for BPHYT_RS08410 in Burkholderia phytofirmans PsJN
Annotation: dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 41% identical to AK1A1_BOVIN: Aldo-keto reductase family 1 member A1 (AKR1A1) from Bos taurus
KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1700)MetaCyc: 43% identical to L-arabinose reductase LarA (Aspergillus niger)
RXN-8773 [EC: 1.1.1.431]; Aldehyde reductase. [EC: 1.1.1.431, 1.1.1.21]
Predicted SEED Role
"2,5-diketo-D-gluconic acid reductase (EC 1.1.1.-)" (EC 1.1.1.-)
MetaCyc Pathways
- L-arabinose degradation II (3/3 steps found)
- D-xylose degradation II (1/1 steps found)
- methylglyoxal degradation III (1/2 steps found)
- superpathway of methylglyoxal degradation (4/8 steps found)
- detoxification of reactive carbonyls in chloroplasts (4/10 steps found)
- superpathway of pentose and pentitol degradation (22/42 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Aminosugars metabolism
- Ascorbate and aldarate metabolism
- Benzoate degradation via CoA ligation
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of type II polyketide products
- Biosynthesis of unsaturated fatty acids
- Bisphenol A degradation
- Butanoate metabolism
- C21-Steroid hormone metabolism
- Fructose and mannose metabolism
- Galactose metabolism
- Glycerolipid metabolism
- Glycine, serine and threonine metabolism
- Insect hormone biosynthesis
- Linoleic acid metabolism
- Nucleotide sugars metabolism
- Pentose and glucuronate interconversions
- Polyketide sugar unit biosynthesis
- Pyruvate metabolism
- Retinol metabolism
- Tetrachloroethene degradation
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.-
Use Curated BLAST to search for 1.1.1.- or 1.1.1.21 or 1.1.1.431
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2T3E7 at UniProt or InterPro
Protein Sequence (313 amino acids)
>BPHYT_RS08410 dehydrogenase (Burkholderia phytofirmans PsJN) MIESSDFRSRKIALDHGGGRVPALGFGTLIPDAATTTSATRDALEAGYRHFDCAERYRNE REVGDALRAGLAAGGIAREEIFVTTKLWNSNHRPERVEPAFDASLERLGLDYLDLYLIHT PFAFKPGDEQDPRDENGDVIYDKGVTLLDTWSAMEELVDRGRCRAIGLSDIGLDELRPLY ESARIKPAVVQVEAHPYLPETELLEFCKEKGIVFLAFAPLGHGIRPGPLEDPVILQIAER IGKTPAQVLLAWAIQRGGALLTTPRTAARARENFDIAALPAEAFDEINRIETRQRYNEVV KTGSPGFIPRRPQ