Protein Info for BPHYT_RS08395 in Burkholderia phytofirmans PsJN

Annotation: DSBA oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 transmembrane" amino acids 43 to 61 (19 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 305 to 328 (24 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 371 to 391 (21 residues), see Phobius details amino acids 402 to 425 (24 residues), see Phobius details amino acids 508 to 530 (23 residues), see Phobius details PF07690: MFS_1" amino acids 52 to 448 (397 residues), 83.8 bits, see alignment E=5.9e-28

Best Hits

KEGG orthology group: None (inferred from 95% identity to bpy:Bphyt_2125)

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3E5 at UniProt or InterPro

Protein Sequence (541 amino acids)

>BPHYT_RS08395 DSBA oxidoreductase (Burkholderia phytofirmans PsJN)
MNSANSPITGTGEPKLAPSSAPVSVPATGIPVQQTSAEAELPLRLTIGLLGMLLASLLAI
LNEQVTAVALADIRGAFSIGRDDGTWLTTLFEATNVATMVFAPWFGVTFTLKRFTIGAVL
AVMVLGLLCPFAPNLLTLYVLRALQGVAGGCLPPMLIIVALRYLPPKVKLYGLAGYALTA
TFGPALGTPLAALWTEYVGWQMAFWQIVPLGLISCVAIYRGLPADPTRLERLRSFNWTGF
LLGYPAIAMLVIGLLQGDRLDWLNSTFIATMFGGGTLLLVAFLINEWFHPLPFFKLQLLA
RRNFAHGLLTLVGAVTLLVGVAAIPGQYLAQIHGYRPLQTTPLFLLVAIPLLISLPATAA
LLNLRQVDHRWVLAVGLCLMAISCFLGSFVTTDWVRENFYWLQSLQILAQPMIIMGILMG
VTTGLPPTEGPFASAMFNTVKTLSGAAATGLIEGLGTAREHFHSAMLVDHLGNNALVTSQ
SIDAAHGLGELAHRLHEQAVVLTSADLYRVMAGIAVAFLFVIPVLPVRVYPPWSTTPPSS
R