Protein Info for BPHYT_RS08190 in Burkholderia phytofirmans PsJN

Annotation: type II secretion system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 124 to 128 (5 residues), see Phobius details amino acids 130 to 156 (27 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details PF00482: T2SSF" amino acids 174 to 300 (127 residues), 41.6 bits, see alignment E=5.7e-15

Best Hits

KEGG orthology group: K12510, tight adherence protein B (inferred from 100% identity to bpy:Bphyt_1656)

Predicted SEED Role

"Flp pilus assembly protein TadB" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T3A5 at UniProt or InterPro

Protein Sequence (342 amino acids)

>BPHYT_RS08190 type II secretion system protein (Burkholderia phytofirmans PsJN)
MSSAVLVFAALALLCAALALLLWQRGAQRKGQASAERYIDSRMAMPTGAAVGGMGGGAAS
TARAAPARVTAQHAVIAPQAPSADAGWLARWRYGQARVRFMVQHAMARAGIANAKAPAAI
AGAIVMLLCGWAAMVGGALAACVALIACVMFFYFLLTMRVNKRRQQIVRQLPLFLDGIVR
LITLGNSVPAAFQAALQTTEAPLRECLDYVSRMLRTGVEIDRALSQVAQIYGVRELELVG
AVLRLSVKYGGRADVMLERMASFMRDLEHAERELVAMSSETRLSSWVLAMLPIGIGGFLI
LSNPKYFASMWFDPTGRQLVYLAFVLQVLGAYLLYRLANLRN