Protein Info for BPHYT_RS08080 in Burkholderia phytofirmans PsJN

Annotation: tRNA pseudouridine synthase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 15 to 222 (208 residues), 267.8 bits, see alignment E=3.2e-84 PF01509: TruB_N" amino acids 36 to 183 (148 residues), 191.2 bits, see alignment E=2e-60 PF16198: TruB_C_2" amino acids 184 to 241 (58 residues), 63.2 bits, see alignment E=3.1e-21 PF09157: TruB-C_2" amino acids 245 to 306 (62 residues), 50.6 bits, see alignment E=2.2e-17

Best Hits

Swiss-Prot: 82% identical to TRUB_BURL3: tRNA pseudouridine synthase B (truB) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 100% identity to bpy:Bphyt_1634)

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T383 at UniProt or InterPro

Protein Sequence (311 amino acids)

>BPHYT_RS08080 tRNA pseudouridine synthase B (Burkholderia phytofirmans PsJN)
MTAPQRPRVPRRALDGVLLLDKPLGLSSNDALIRAKRLYLAKKAGHTGTLDPLATGLLPL
CFGEATKFSQDLLEANKTYEATMRLGVRTTTGDAEGEAIDTREVTCDEAAILAVLPTFLG
EITQVPPMYSALKRDGKPLYEYARAGQTVEREGRQVTILALEMLACALPDVTFRVTCSKG
TYVRTLAEDIGEALGCGAHLVALRRTGVGALTLDNSVTLDALSDAAESERDAWLQPVDAL
LSTFPLVRLNEDATRRFLHGQRLKLSELTITGDAVNAPRVRVYAEQGRLLGVAKQGEGVL
APERLVVTTES