Protein Info for BPHYT_RS08070 in Burkholderia phytofirmans PsJN

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 986 PF04760: IF2_N" amino acids 1 to 51 (51 residues), 29.6 bits, see alignment 1.7e-10 amino acids 410 to 460 (51 residues), 52.7 bits, see alignment 1e-17 PF08364: IF2_assoc" amino acids 61 to 99 (39 residues), 55 bits, see alignment (E = 2.8e-18) TIGR00487: translation initiation factor IF-2" amino acids 405 to 986 (582 residues), 872.5 bits, see alignment E=1.7e-266 TIGR00231: small GTP-binding protein domain" amino acids 489 to 645 (157 residues), 107.4 bits, see alignment E=6.3e-35 PF01926: MMR_HSR1" amino acids 491 to 596 (106 residues), 37.7 bits, see alignment E=6.8e-13 PF00009: GTP_EFTU" amino acids 491 to 646 (156 residues), 127 bits, see alignment E=2.5e-40 PF22042: EF-G_D2" amino acids 661 to 740 (80 residues), 102.6 bits, see alignment E=3.6e-33 PF11987: IF-2" amino acids 762 to 876 (115 residues), 148.6 bits, see alignment E=2.6e-47

Best Hits

Swiss-Prot: 84% identical to IF2_BURCM: Translation initiation factor IF-2 (infB) from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 86% identity to bgl:bglu_1g20020)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T381 at UniProt or InterPro

Protein Sequence (986 amino acids)

>BPHYT_RS08070 translation initiation factor IF-2 (Burkholderia phytofirmans PsJN)
MASNNVAQFAAELKMPAGVLLEQLQAAGVTKASEDDSLSETDKARLLDHLRKSHGSTDAD
KRKITLTKRHTSEIKQSDATGKARTIQVEVRKKRTFVRRDETSAENGDASNHVAEADVDD
LELQRREEEARHEAELLEKQAQELKARQEQLEREEAERQAREAAAEAERRRAEEEAAKKR
AAAEAAAREQAQAAKPAQAAQPAAAKAEPVAAKAAEPAVAKQSEQDDERAAAERAAQREA
AKKAEDAARQAAEKARAEQEQIAKRRAAAEAEARAIREMMNTPRKAQVKAPEPAPKPAEP
AKAAEAKGTLHKPARPAGEAPSRPAAKKPAAAAPAATTTPSAGDKKKPGGGKGGWQDDAA
KRRGIKTRGDTSGGVDRGWRGGPKGRGKHQDQNTTFQAPTEPIVREVHVPETITVADLAH
KMAVKASEVIKSMMKLGQMVTINQMLDQETAMIIVEELGHHAVAAKLDDPEAMLVEGEIS
DAESLPRPPVVTVMGHVDHGKTSLLDYIRRAKVAAGEAGGITQHIGAYHVETPRGVITFL
DTPGHEAFTAMRARGAKATDIVILVVAADDGVMPQTKEAIAHAKAGGVPLVVAINKIDKP
DANPDRVKQELVAEGVVPEEYGGDSPFVSVSAKTGAGIDDLLENVLLQAEVLELKAPVEA
PAKGLVIEAKLDKGKGPVATILVQSGTLNRGDVVLAGSAYGRVRAMLDETGKPTKSAGPS
IPVEIQGLSEVPQAGEEVIVMPDDRKAREVALFRQGKFRDVKLAKQQAAKLENMLEQMGE
GEVAYMPLIVKADVQGSQEALVQSLLKLSTDEVRVQIVHGAVGGISESDVNLATASKAVI
IGFNTRADAQARKLAEANGVDIRYYNIIYDAVDEVKAAMSGMLAPEKREIVTGTVEVRQV
FKVPKIGAVAGCMVTDGFVKRSSSVRVLRNNVVIFTGELDSLKRFKDDVKEVRQGFECGM
SIKNFNDIVEGDQFEVFEITEVARTL