Protein Info for BPHYT_RS07865 in Burkholderia phytofirmans PsJN
Annotation: NADH oxidase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 55% identical to XYLZ_PSEPU: Toluate 1,2-dioxygenase electron transfer component (xylZ) from Pseudomonas putida
KEGG orthology group: K05784, benzoate 1,2-dioxygenase electron transfer component (inferred from 100% identity to bpy:Bphyt_1593)MetaCyc: 55% identical to XylZ (Pseudomonas putida mt-2)
Benzoate 1,2-dioxygenase. [EC: 1.14.12.10]
Predicted SEED Role
"2-chlorobenzoate 1,2-dioxygenase reductase component"
MetaCyc Pathways
- benzoate degradation I (aerobic) (2/2 steps found)
- meta cleavage pathway of aromatic compounds (7/10 steps found)
- mandelate degradation to acetyl-CoA (12/18 steps found)
- toluene degradation IV (aerobic) (via catechol) (7/13 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (21/35 steps found)
- superpathway of aerobic toluene degradation (14/30 steps found)
- superpathway of aromatic compound degradation via 2-hydroxypentadienoate (16/42 steps found)
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Fluorobenzoate degradation
Isozymes
Compare fitness of predicted isozymes for: 1.14.12.10
Use Curated BLAST to search for 1.14.12.10
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2T342 at UniProt or InterPro
Protein Sequence (340 amino acids)
>BPHYT_RS07865 NADH oxidase (Burkholderia phytofirmans PsJN) MSSYNIALNFEDGVTRFVTCKAGEKVLDAAFRAKINLPMDCSDGVCGTCKCRAESGSYDL GDDYIEDALSEDEKESGLVLTCQMVPESDCVIAVPASSTACKTEQSKFAATVTKVEAHND AAIVLELDVEAAAPVFLPGQYVNIDVPGSGQHRSYSFSSAPGESKISFLIKKISGGVMST WLESAQAGNKVELTGPLGSFYLRAVERPLLFLAGGTGLAPFLSMLEVLARTNSQQKVHLI YGVTRDLDLVQVDAIEAYVAKLPNFTYSTVVADTESTHPRKGWVTQHMPAEAVNDGDVDV YLCGPPPMVDAVRKHFDDNGVKPNSFHYEKFTPNAAPRTA