Protein Info for BPHYT_RS07860 in Burkholderia phytofirmans PsJN

Annotation: benzoate 1,2-dioxygenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03232: benzoate 1,2-dioxygenase, small subunit
  • amino acids 8 to 162 (155 residues), 237.6 bits, E=2.6e-75
• PF00866: Ring_hydroxyl_B
  • amino acids 14 to 154 (141 residues), 162.3 bits, E=8.4e-52

Best Hits

Swiss-Prot: 57% identical to XYLY_PSEPU: Toluate 1,2-dioxygenase subunit beta (xylY) from Pseudomonas putida

KEGG orthology group: K08686, 2-chlorobenzoate 1,2-dioxygenase [EC: 1.14.12.13] (inferred from 100% identity to bpy:Bphyt_1592)

MetaCyc: 57% identical to XylY (Pseudomonas putida mt-2)
Benzoate 1,2-dioxygenase. [EC: 1.14.12.10]

Predicted SEED Role

"Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

• benzoate degradation I (aerobic) (2/2 steps found)
• 2-chlorobenzoate degradation (1/1 steps found)
• meta cleavage pathway of aromatic compounds (7/10 steps found)
• mandelate degradation to acetyl-CoA (12/18 steps found)
• toluene degradation IV (aerobic) (via catechol) (7/13 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (21/35 steps found)
• superpathway of aerobic toluene degradation (14/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (16/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10, 1.14.12.13

Use Curated BLAST to search for 1.14.12.10 or 1.14.12.13

Sequence Analysis Tools

See B2T341 at UniProt or InterPro

Protein Sequence (162 amino acids)

>BPHYT_RS07860 benzoate 1,2-dioxygenase subunit beta (Burkholderia phytofirmans PsJN)
MSFDHQTICAVLFREARLLDDRQWDEWLACYTEDVTYWMPAWDDDDQLTDDHESQISLMY
YPDRGGLEDRVFRIKTERSSASMPEPRTSHNVTNVEVLAERENEVDVRYNFNTLSHRYRT
TDQFFGTMFVTLRKVNDELLICYKRIVLKDDYIRQVLDVYHV