Protein Info for BPHYT_RS07850 in Burkholderia phytofirmans PsJN

Annotation: catechol 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02439: catechol 1,2-dioxygenase
  • amino acids 7 to 290 (284 residues), 447.2 bits, E=9.2e-139
• PF04444: Dioxygenase_N
  • amino acids 28 to 95 (68 residues), 72 bits, E=2.9e-24
• PF00775: Dioxygenase_C
  • amino acids 105 to 291 (187 residues), 213.2 bits, E=2.1e-67

Best Hits

Swiss-Prot: 80% identical to CATA1_ACILW: Catechol 1,2-dioxygenase 1 (catA1) from Acinetobacter lwoffii

KEGG orthology group: K03381, catechol 1,2-dioxygenase [EC: 1.13.11.1] (inferred from 100% identity to bpy:Bphyt_1590)

MetaCyc: 55% identical to catechol-1,2-dioxygenase (Pseudomonas reinekei)
Catechol 1,2-dioxygenase. [EC: 1.13.11.1]

Predicted SEED Role

"Catechol 1,2-dioxygenase (EC 1.13.11.1)" in subsystem Catechol branch of beta-ketoadipate pathway (EC 1.13.11.1)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• superpathway of salicylate degradation (7/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
• catechol degradation to β-ketoadipate (4/4 steps found)
• mandelate degradation to acetyl-CoA (12/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (21/35 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Carbazole degradation
• Fluorobenzoate degradation
• Toluene and xylene degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.1

Use Curated BLAST to search for 1.13.11.1

Sequence Analysis Tools

See B2T339 at UniProt or InterPro

Protein Sequence (311 amino acids)

>BPHYT_RS07850 catechol 1,2-dioxygenase (Burkholderia phytofirmans PsJN)
MSVKVFDTKEVQDLLKAAANVGSQDGGARAKQIVNRLLGDLFKAIDDLDMTPDEIWAGVH
YFNKLGQDGEAALLAAGLGLEKYLDIRMDAEDKAAEITGGTPRTIEGPLYVAGAPVREGV
SRIDIDPDEDAGPLVIRGTVTGPDGKPVAGALVECWHANSKGFYSHFDPTSKQSEFNLRG
AVSTGADGKYEFRTLMPVGYGCPPHGATQQLLDVLGRHGNRPAHVHFFVTADKSRKLTTQ
INIEGDPLIWDDFAYATREDLIPHVVEKTGGTALGMKTDAYKEIQFDIELTPLIQGKDNQ
LVHRPRVSVSA