Protein Info for BPHYT_RS07845 in Burkholderia phytofirmans PsJN

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF00126: HTH_1" amino acids 3 to 62 (60 residues), 89 bits, see alignment E=1.6e-29 PF03466: LysR_substrate" amino acids 89 to 288 (200 residues), 138.3 bits, see alignment E=2.5e-44

Best Hits

Swiss-Prot: 47% identical to BENM_ACIAD: HTH-type transcriptional regulator BenM (benM) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_1589)

Predicted SEED Role

"Aromatic hydrocarbon utilization transcriptional regulator CatR (LysR family)" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T338 at UniProt or InterPro

Protein Sequence (307 amino acids)

>BPHYT_RS07845 LysR family transcriptional regulator (Burkholderia phytofirmans PsJN)
MELRHLRYFVAVAEERNFTRAAQRLNMAQPPLSRQIQQLEEILEVQLFQRDSRPLKLTET
GKFFYAHAVQLLAQTSELESMTRRVGNIERSLSVGFVGSTLYGMLPKIIRRFRDENTTVE
LSLHEMSTMDQIRALKDGQIDVGFGRIRHEDPNIRRVILREEKMIVAFPEGHPLSLAKPV
LALSDLVNETLIIFPKAPRPSYADQVLSAFEDRGLKPRRIYEVRELQIALGLVAAGEGIS
VVPSSVYGLKRDDVSYKELDDPTLVSPIIMSMRALDESRDIREMLELIYRLYEEEKISFA
PRNDSGP