Protein Info for BPHYT_RS07585 in Burkholderia phytofirmans PsJN

Updated annotation (from data): N-formylglutamate deformylase (EC 3.5.1.68)
Rationale: Specifically important for utilizing L-Histidine. Automated validation from mutant phenotype: the predicted function (N-FORMYLGLUTAMATE-DEFORMYLASE-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: N-formylglutamate amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 TIGR02017: N-formylglutamate deformylase" amino acids 10 to 265 (256 residues), 350.3 bits, see alignment E=3.4e-109 PF05013: FGase" amino acids 18 to 237 (220 residues), 252.8 bits, see alignment E=2.1e-79

Best Hits

KEGG orthology group: K01458, N-formylglutamate deformylase [EC: 3.5.1.68] (inferred from 100% identity to bpy:Bphyt_1536)

MetaCyc: 48% identical to N-formylglutamate amidohydrolase (Pseudomonas putida)
N-formylglutamate deformylase. [EC: 3.5.1.68]

Predicted SEED Role

"N-formylglutamate deformylase (EC 3.5.1.68)" in subsystem Histidine Degradation (EC 3.5.1.68)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.68

Use Curated BLAST to search for 3.5.1.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T2Y8 at UniProt or InterPro

Protein Sequence (271 amino acids)

>BPHYT_RS07585 N-formylglutamate deformylase (EC 3.5.1.68) (Burkholderia phytofirmans PsJN)
MTASNTPPVFSLHRGSLPLLISIPHLGTQIPADIAATMTPAAQRTDDCDWHLDRLYAFAK
RMGASILAPTYARYVIDLNRPPDGANLYPGQDTTGLLPVDTFDKEPLYLDGQLPDEAETT
RRRDAYWKPYHEALQGELAALKAKHGKVLLWEAHSIRSHVPRFFEGRLPDFNFGTSNGAS
AVAGLAEEMAATVEQYDGGYTAVANGRFKGGYITREYGQPSQGVHALQLELSQITYMEEH
MPYAYDETLAAKVEPLLEALVVKALERVKTA